PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018240-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 357aa    MW: 40101.2 Da    PI: 7.1766
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018240-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.9e-174996148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+ Ed++l+d++k +G g W+  +++ g++R++k+c++rw++yl
    NNU_018240-RA 49 RGAWTAHEDKILKDYIKIHGEGKWRNLPKKAGLKRCGKSCRLRWLNYL 96
                     89********************************************97 PP

2Myb_DNA-binding52.11.5e-16102146147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
    NNU_018240-RA 102 RGNITHDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 146
                      7999******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-234099IPR009057Homeodomain-like
PROSITE profilePS5129416.7524496IPR017930Myb domain
SuperFamilySSF466891.19E-2747143IPR009057Homeodomain-like
SMARTSM007171.2E-134898IPR001005SANT/Myb domain
PfamPF002495.3E-144996IPR001005SANT/Myb domain
CDDcd001671.01E-105196No hitNo description
PROSITE profilePS5129425.16997151IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-23100151IPR009057Homeodomain-like
SMARTSM007178.6E-15101149IPR001005SANT/Myb domain
PfamPF002491.7E-14102147IPR001005SANT/Myb domain
CDDcd001672.39E-11106147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
GILWAPYYKN PSLTHTLTCE TNNKGFGVPS LESLQMGRSP CCSKEGLNRG AWTAHEDKIL  60
KDYIKIHGEG KWRNLPKKAG LKRCGKSCRL RWLNYLRPDI KRGNITHDEE ELIVRLHRLL  120
GNRWSLIAGR LPGRTDNEIK NYWNTNLVKK VQGHPKTTTT STQHRDPNMS KGSNKKKKKK  180
PIPPSPATPN AESRVVRTKA LRCTKVFLSP PHNQVEHIGV NDASPTVVVP TTVGVDIATP  240
PAVDSESYDG LSSFTPRDDN SPDFMMDFNV DEFCLTDLLN SDLSQLCQFD NGVLGETETN  300
CCNDDNNGLS PYSDQPLFYP DEMLEEWTGS DCVKPDVVSD LRTLATFLDC EENWLAQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-244715125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273927.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLA0A061GMC61e-116A0A061GMC6_THECC; GHMYB10, putative
STRINGVIT_11s0016g01300.t011e-107(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.17e-62MYB family protein